PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29692.m000540
Common NameRCOM_0629510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 609aa    MW: 67287.9 Da    PI: 6.0775
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29692.m000540genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.52e-1402405991374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    lv+lL++cAeav++++l+la+al++++  la +++ +m+++a+yf+eALa+r++r    ly    p++  +++ s+ l++   f+e++P+lkf+h+
  29692.m000540 240 LVHLLMACAEAVQQNNLTLAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYR----LY----PQSPIDHSLSDILQM--HFYETCPYLKFAHF 325
                    68*****************************************************....44....444444446666555..5************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    taNqaIlea+eg++rvH+iDf+++qG+QWpaLlqaLa Rp+gpp +R+Tg+g+p++++++ l+e+g++La++Ae+++v+fe++ +va++l+dl+ +
  29692.m000540 326 TANQAILEAFEGKKRVHVIDFSMNQGMQWPALLQALALRPGGPPAFRLTGIGPPSHDNSDHLQEVGWKLAQLAETIHVEFEYRGFVANSLADLDAS 421
                    ************************************************************************************************ PP

           GRAS 193 eLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                    +L++++   E++aVn+v++lh+ll++++++++    vL++vk+++P++v++veqea+hn++ Fl+rf+e+l+yys+lfdsle ++   s ++++++
  29692.m000540 422 MLELRHteFESVAVNSVFELHKLLARPGAIDK----VLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEGSV---STQDKVMS 510
                    **99997789**************99999988....************************************************7...9999**** PP

           GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    +++lg++i+nvvacega+r+erhetl +Wr rl+ aGF pv+l+++a kqa++ll+ ++ +dgyrv+e++g+l+lgW++rpL+++SaWr
  29692.m000540 511 EVYLGKQICNVVACEGADRVERHETLTQWRTRLGLAGFAPVHLGSNAFKQASMLLALFAgGDGYRVDENNGCLMLGWHTRPLIATSAWR 599
                    ****************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011294.0E-4057130No hitNo description
PfamPF120412.8E-3757124IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098567.981214578IPR005202Transcription factor GRAS
PfamPF035147.0E-138240599IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MKREHPNLHP RLDPAGVGSS SSTGYPTMAN NTYFNEVNTC KGKIWEDEEA KGDGGMDELL  60
AVLGYKVRSS DMAEVAQKLE QLEEVMGNVQ EDGLCQLASE TVHYNPSDLS TWLESMLSEL  120
NPNPNFDPSQ QPDSFSAPPP ESSTITSIDF DQNQTHHLRQ HQSQGQLHKA KHNRAVFAQT  180
HIDSSASSSS SSSRDPKRLK PTTTTTNPYS SAPVAPPATV TEPTTRPVVL VDSQENGIRL  240
VHLLMACAEA VQQNNLTLAE ALVKQIGFLA VSQAGAMRKV ATYFAEALAR RIYRLYPQSP  300
IDHSLSDILQ MHFYETCPYL KFAHFTANQA ILEAFEGKKR VHVIDFSMNQ GMQWPALLQA  360
LALRPGGPPA FRLTGIGPPS HDNSDHLQEV GWKLAQLAET IHVEFEYRGF VANSLADLDA  420
SMLELRHTEF ESVAVNSVFE LHKLLARPGA IDKVLSVVKQ MKPEIVTIVE QEANHNGPVF  480
LDRFTESLHY YSTLFDSLEG SVSTQDKVMS EVYLGKQICN VVACEGADRV ERHETLTQWR  540
TRLGLAGFAP VHLGSNAFKQ ASMLLALFAG GDGYRVDENN GCLMLGWHTR PLIATSAWRL  600
ASKQVVLAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-522405994375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015580029.10.0PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B
SwissprotQ8S4W70.0GAI1_VITVI; DELLA protein GAI1
TrEMBLB9SP750.0B9SP75_RICCO; DELLA protein GAIP-B, putative
STRINGPOPTR_0008s13090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80334121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.10.0GRAS family protein